Descrição
This recombinant protein is the major form secreted by macrophages. IL-8 is a chemokine produced by macrophages and other cell types, such as epithelial cells, airway smooth muscle cells, and endothelial cells.
Specifications
|
Cat.No. |
90304ES08 / 90304ES20 |
|
Size |
5 μg / 20 μg |
Components
|
Name |
90304ES08 |
90304ES20 |
|
HiActi™ Recombinant Porcine IL-8 Protein, His Tag |
5 μg |
20 μg |
Performance parameters
|
Synonyms |
interleukin 8, IL8, AMCF-I, CXCL8 |
|
Species |
Porcine |
|
Expression Sequence |
MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ with polyhistidine tag at the C-terminus. |
|
Accession |
P26894 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 10.04 kDa. The protein migrates about 11 kDa under reducing condition. |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <5 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Pagamento e segurança
Suas informações de pagamento são processadas com segurança. Não armazenamos detalhes do cartão de crédito nem temos acesso às informações do seu cartão de crédito.
Você também pode gostar
Investigação
Perguntas frequentes
O produto é apenas para fins de pesquisa e não se destina ao uso terapêutico ou diagnóstico em humanos ou animais. Os produtos e o conteúdo são protegidos por patentes, marcas registradas e direitos autorais de propriedade da
Certos aplicativos podem exigir direitos adicionais de propriedade intelectual de terceiros.