Keterangan
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
Pembayaran & Keamanan
Informasi pembayaran Anda diproses dengan aman. Kami tidak menyimpan detail kartu kredit atau memiliki akses ke informasi kartu kredit Anda.
Pertanyaan
Anda mungkin juga menyukai
FAQ
Produk ini hanya untuk keperluan penelitian dan tidak ditujukan untuk penggunaan terapeutik atau diagnostik pada manusia atau hewan. Produk dan konten dilindungi oleh paten, merek dagang, dan hak cipta milik
Aplikasi tertentu mungkin memerlukan hak kekayaan intelektual pihak ketiga tambahan.

