Description
Galectin-10 (Gal-10) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosides, and exists as a biologically active homodimer. Galectin-10 has been reported to be present in eosinophils, as well as in basophils and macrophages. Accumulating evidence indicates that galectin-10 spontaneously forms Charcot-Leyden crystals (CLCs), which are involved in allergic reactions and related inflammatory responses. Multiple binding partners for galectin-10 have been identified, including eosinophil cationic ribonuclease, eosinophil-derived neurotoxin (EDN, RNS2), and eosinophil cationic protein (ECP, RNS3), suggesting that these interactions are crucial for eosinophil differentiation and granule formation.
Specifications
|
Cat.No. |
92312ES08 / 92312ES20 / 92312ES60 / 92312ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92312ES08 |
92312ES20 |
92312ES60 |
92312ES76 |
|
HiActi™ Recombinant Human Galectin-10 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN |
|
Species |
Human |
|
Expression Sequence |
SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR with polyhistidine tag at the N-terminus. |
|
Accession |
Q05315 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 16.31 kDa. The protein migrates as 16-19 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to chemoattract human THP1 cells using a concentration range of 0.2-25 µg/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Paiement et sécurité
Vos informations de paiement sont traitées en toute sécurité. Nous ne stockons pas les détails de la carte de crédit ni accès aux informations de votre carte de crédit.
Vous pouvez aussi aimer
Enquête
FAQ
Le produit est destiné à des fins de recherche uniquement et n'est pas destiné à un usage thérapeutique ou diagnostique chez l'homme ou l'animal. Les produits et le contenu sont protégés par des brevets, des marques déposées et des droits d'auteur appartenant à Yeasen Biotechnology. Les symboles de marque indiquent le pays d'origine, pas nécessairement l'enregistrement dans toutes les régions.
Certaines applications peuvent nécessiter des droits de propriété intellectuelle tiers supplémentaires.
Yeasen se consacre à la science éthique, estimant que nos recherches doivent répondre à des questions cruciales tout en garantissant la sécurité et les normes éthiques.

