Description
Mouse insulin-like growth factor 2 (IGF-II) is a member of the insulin-like growth factor family with a molecular weight of 7.34 kDa, comprising 67 amino acid residues. IGF-II is primarily expressed in early embryonic somatic tissues, the liver, and the epithelial cells of the brain surface. It mediates embryonic development and placental growth, while also promoting tumor growth. IGF-II regulates cell proliferation, growth, migration, differentiation, and survival by binding to the IGF-I receptor.
Specifications
|
Cat.No. |
92206ES08 / 92206ES20 / 92206ES60 / 92206ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92206ES08 |
92206ES20 |
92206ES60 |
92206ES76 |
|
HiActi™ Recombinant Mouse IGF-II Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
insulin-like growth factor-II, AL033362, Igf-2, M6pr, Mpr, Peg, Peg2 |
|
Species |
Mouse |
|
Expression Sequence |
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus. |
|
Accession |
P09535 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 8.20 kDa. The protein migrates about 11 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 10⁵ IU/mg. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Paiement et sécurité
Vos informations de paiement sont traitées en toute sécurité. Nous ne stockons pas les détails de la carte de crédit ni accès aux informations de votre carte de crédit.
Vous pouvez aussi aimer
Enquête
FAQ
Le produit est destiné à des fins de recherche uniquement et n'est pas destiné à un usage thérapeutique ou diagnostique chez l'homme ou l'animal. Les produits et le contenu sont protégés par des brevets, des marques déposées et des droits d'auteur appartenant à Yeasen Biotechnology. Les symboles de marque indiquent le pays d'origine, pas nécessairement l'enregistrement dans toutes les régions.
Certaines applications peuvent nécessiter des droits de propriété intellectuelle tiers supplémentaires.
Yeasen se consacre à la science éthique, estimant que nos recherches doivent répondre à des questions cruciales tout en garantissant la sécurité et les normes éthiques.

