Beskrivelse
Galectin-14 (Gal-14) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosides, and exists as a biologically active homodimer. Similar to galectin-13, which is expressed in the placenta and involved in T-cell apoptosis, immune regulation, and immune tolerance, galectin-14 plays a crucial role in fetal development. It enhances trophoblast cell migration and invasion by promoting the expression of MMP-9 and N-cadherin via the Akt pathway. Additionally, galectin-14 stimulates unprimed T cells to produce IL-8, a process associated with angiogenesis at the maternal-fetal interface.
Specifications
|
Cat.No. |
92315ES08 / 92315ES20 / 92315ES60 / 92315ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92315ES08 |
92315ES20 |
92315ES60 |
92315ES76 |
|
HiActi™ Recombinant Human Galectin-14 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
LGALS14, CLC2, PPL13 |
|
Species |
Human |
|
Expression Sequence |
SSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD with polyhistidine tag at the N-terminus. |
|
Accession |
Q8TCE9 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Betaling og sikkerhed
Dine betalingsoplysninger behandles sikkert. Vi gemmer ikke kreditkortoplysninger og har heller ikke adgang til dine kreditkortoplysninger.
Du kan også lide
Forespørgsel
FAQ
Produktet er kun til forskningsformål og er ikke beregnet til terapeutisk eller diagnostisk brug hos mennesker eller dyr. Produkter og indhold er beskyttet af patenter, varemærker og ophavsrettigheder ejet af Yeasen Biotechnology. Varemærkesymboler angiver oprindelseslandet, ikke nødvendigvis registrering i alle regioner.
Visse applikationer kan kræve yderligere tredjeparts intellektuelle ejendomsrettigheder.
Yeasen er dedikeret til etisk videnskab og mener, at vores forskning bør adressere kritiske spørgsmål og samtidig sikre sikkerhed og etiske standarder.