Frequently Bought Together
Interferon alpha-1a (IFN-α1a) is a leukocyte interferon and a variant of interferon-alpha. It is a protein with a molecular weight of 18.4 kDa, consisting of 166 amino acid residues. IFN-α1a binds to the interferon receptor, thereby activating immune response signal transduction via the JAK/STAT pathway in leukocytes and lymphoblasts.
Specifications
|
Cat.No. |
91232ES08 / 91232ES20 / 91232ES60 / 91232ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 100 μg |
Components
|
Name |
91232ES08 |
91232ES20 |
91232ES60 |
91232ES76 |
|
HiActi™ Recombinant Mouse IFN-alpha 1a, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interferon alpha 1a, Ifa, Ifa8, IFNA |
|
Species |
Mouse |
|
Expression Sequence |
CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus. |
|
Accession |
P01572 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10⁷ IU/mg. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Storage
FAQ
Citations
Documents
Applications
Du kan også lide
Forespørgsel
FAQ
Produktet er kun til forskningsformål og er ikke beregnet til terapeutisk eller diagnostisk brug hos mennesker eller dyr. Produkter og indhold er beskyttet af patenter, varemærker og ophavsrettigheder ejet af Yeasen Biotechnology. Varemærkesymboler angiver oprindelseslandet, ikke nødvendigvis registrering i alle regioner.
Visse applikationer kan kræve yderligere tredjeparts intellektuelle ejendomsrettigheder.
Yeasen er dedikeret til etisk videnskab og mener, at vores forskning bør adressere kritiske spørgsmål og samtidig sikre sikkerhed og etiske standarder.

