Frequently Bought Together
The predicted molecular weight of Interleukin-28B (IL-28B) is 19.7 kDa. There are two isoforms of IL-28: IL-28A and IL-28B, which play a role in antiviral immune defense. This includes inducing an "antiviral state" by activating Mx proteins, 2',5'-oligoadenylate synthetase, and ISGF3G.
Specifications
|
Cat.No. |
90294ES08 / 90294ES20 / 90294ES60 / 90294ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
90294ES08 |
90294ES20 |
90294ES60 |
90294ES76 |
|
HiActi™ Recombinant Mouse IL-28B Protein ,His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interleukin 28B, interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL28B |
|
Species |
Mouse |
|
Expression Sequence |
MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus. |
|
Accession |
Q8IZI9 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 25.57 kDa. The protein migrates as 21 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Storage
FAQ
Citations
Documents
Applications
Du kan også lide
Forespørgsel
FAQ
Produktet er kun til forskningsformål og er ikke beregnet til terapeutisk eller diagnostisk brug hos mennesker eller dyr. Produkter og indhold er beskyttet af patenter, varemærker og ophavsrettigheder ejet af Yeasen Biotechnology. Varemærkesymboler angiver oprindelseslandet, ikke nødvendigvis registrering i alle regioner.
Visse applikationer kan kræve yderligere tredjeparts intellektuelle ejendomsrettigheder.
Yeasen er dedikeret til etisk videnskab og mener, at vores forskning bør adressere kritiske spørgsmål og samtidig sikre sikkerhed og etiske standarder.

