Beskrivelse
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
Betaling og sikkerhed
Dine betalingsoplysninger behandles sikkert. Vi gemmer ikke kreditkortoplysninger og har heller ikke adgang til dine kreditkortoplysninger.
Forespørgsel
Du kan også lide
FAQ
Produktet er kun til forskningsformål og er ikke beregnet til terapeutisk eller diagnostisk brug hos mennesker eller dyr. Produkter og indhold er beskyttet af patenter, varemærker og ophavsrettigheder ejet af Yeasen Biotechnology. Varemærkesymboler angiver oprindelseslandet, ikke nødvendigvis registrering i alle regioner.
Visse applikationer kan kræve yderligere tredjeparts intellektuelle ejendomsrettigheder.
Yeasen er dedikeret til etisk videnskab og mener, at vores forskning bør adressere kritiske spørgsmål og samtidig sikre sikkerhed og etiske standarder.

