Tanım
Galectin-13 (Gal-13) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosides, and exists as a biologically active homodimer. Expressed in the placenta, galectin-13 participates in T-cell apoptosis, immune regulation, and immune tolerance, all of which are crucial for fetal development. For instance, galectin-13 forms crystal-like aggregates in the decidua, which attract and eliminate maternal immune cells. Furthermore, galectin-13 is essential for neutrophil polarization in the placental growth-permissive phenotype.
Specifications
|
Cat.No. |
92314ES08 / 92314ES20 / 92314ES60 / 92314ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92314ES08 |
92314ES20 |
92314ES60 |
92314ES76 |
|
HiActi™ Recombinant Human Galectin-13 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
LGALS13, GAL13, PLAC8, PP13 |
|
Species |
Human |
|
Expression Sequence |
SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN with polyhistidine tag at the N-terminus. |
|
Accession |
Q9UHV8 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Ödeme ve Güvenlik
Ödeme bilgileriniz güvenli bir şekilde işlenir. Kredi kartı ayrıntılarını saklamıyoruz veya kredi kartı bilgilerinize erişimimiz yok.
Ayrıca sevebilirsiniz
Sorgu
SSS
Ürün yalnızca araştırma amaçlıdır ve insanlarda veya hayvanlarda terapötik veya teşhis amaçlı kullanım için tasarlanmamıştır. Ürünler ve içerikler, Yeasen Biotechnology'nin sahip olduğu patentler, ticari markalar ve telif haklarıyla korunmaktadır. Ticari marka sembolleri, tüm bölgelerde tescilli olmayıp, menşe ülkesini gösterir.
Bazı uygulamalar üçüncü tarafların ek fikri mülkiyet haklarına ihtiyaç duyabilir.
Yeasen, araştırmalarımızın güvenlik ve etik standartları sağlarken kritik soruları ele alması gerektiğine inanarak etik bilime kendini adamıştır.