Descrizione
Neurturin is a cytokine with a molecular weight of 22 kDa, consisting of 195 amino acid residues. Along with GDNF, it belongs to the glial cell line-derived neurotrophic factor (GDNF) family. Neurturin binds to GFRα-2 (a GPI-anchored receptor known as GDNF family receptor alpha-2), thereby activating the Ret receptor tyrosine kinase and the MAPK signaling pathway. It plays a crucial role in neuronal survival.
Specifications
|
Cat.No. |
92137ES08 / 92137ES20 / 92137ES60 / 92137ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92137ES08 |
92137ES20 |
92137ES60 |
92137ES76 |
|
HiActi™ Recombinant Mouse Neurturin Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
NTN, NRTN |
|
Species |
Mouse |
|
Expression Sequence |
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV with polyhistidine tag at the N-terminus. |
|
Accession |
P97463 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 12.33 kDa. The protein migrates as 11-17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Pagamento e sicurezza
Le informazioni di pagamento vengono elaborate in modo sicuro. Non archiviamo i dettagli della carta di credito né abbiamo accesso alle informazioni sulla tua carta di credito.
Potrebbe piacerti anche
Indagine
FAQ
Il prodotto è solo per scopi di ricerca e non è destinato all'uso terapeutico o diagnostico su esseri umani o animali. Prodotti e contenuti sono protetti da brevetti, marchi e copyright di proprietà di Yeasen Biotechnology. I simboli dei marchi indicano il paese di origine, non necessariamente la registrazione in tutte le regioni.
Alcune applicazioni potrebbero richiedere ulteriori diritti di proprietà intellettuale di terze parti.
Yeasen è un sostenitore della scienza etica, convinto che la nostra ricerca debba affrontare questioni critiche garantendo al contempo sicurezza e standard etici.

