Descrizione
Interferon alpha-1a (IFN-α1a) is a leukocyte interferon and a variant of interferon-alpha. It is a protein with a molecular weight of 18.4 kDa, consisting of 166 amino acid residues. IFN-α1a binds to the interferon receptor, thereby activating immune response signal transduction via the JAK/STAT pathway in leukocytes and lymphoblasts.
Specifications
|
Cat.No. |
91232ES08 / 91232ES20 / 91232ES60 / 91232ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 100 μg |
Components
|
Name |
91232ES08 |
91232ES20 |
91232ES60 |
91232ES76 |
|
HiActi™ Recombinant Mouse IFN-alpha 1a, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interferon alpha 1a, Ifa, Ifa8, IFNA |
|
Species |
Mouse |
|
Expression Sequence |
CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus. |
|
Accession |
P01572 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10⁷ IU/mg. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Pagamento e sicurezza
Le informazioni di pagamento vengono elaborate in modo sicuro. Non archiviamo i dettagli della carta di credito né abbiamo accesso alle informazioni sulla tua carta di credito.
Potrebbe piacerti anche
Indagine
FAQ
Il prodotto è solo per scopi di ricerca e non è destinato all'uso terapeutico o diagnostico su esseri umani o animali. Prodotti e contenuti sono protetti da brevetti, marchi e copyright di proprietà di Yeasen Biotechnology. I simboli dei marchi indicano il paese di origine, non necessariamente la registrazione in tutte le regioni.
Alcune applicazioni potrebbero richiedere ulteriori diritti di proprietà intellettuale di terze parti.
Yeasen è un sostenitore della scienza etica, convinto che la nostra ricerca debba affrontare questioni critiche garantendo al contempo sicurezza e standard etici.