Descrizione
Components
Components No. |
Name |
20543ES10 |
20543ES60 |
20543 |
RNase A (10 mg/mL) |
10 mg |
100 mg |
Product Properties
Synonyms |
Recombinant protein A alkali-tolerant |
Source |
E.coli |
Molecular Weight |
Approximately 26.7 kDa, a single non-glycosylated polypeptide chain containing 237amino acids |
Amino Acid Sequence |
AQGTVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLND AQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLN DAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKL NDAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPKC |
Concentration for 1 unity OD at 280 nm |
4.4 mg/mL |
Physical Appearance |
> 97 % by SDS-PAGE and HPLC analyses. |
Purity |
> 97% by SDS-PAGE and HPLC analyses. |
Endotoxin Level |
<0.1 EU /1 μg of the protein by the LAL method. |
Formulation |
A 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4 or lyophilized from a 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4 |
Reconstitution |
Dissolve in distilled water or saline. |
Storage
This product should be stored at -25~ -15℃, valid for 12 months. Avoid repeated freeze-thaw cycles.
Notes
1. Please operate with lab coats and disposable gloves ,for your safety.
2. This product is for research use only.
Appendix
Table 1. Summary of Binding Abilities of Proteins A, G, and L to Ig from Different Species

Documents:
Safety Data Sheet
Manuals
Pagamento e sicurezza
Le informazioni di pagamento vengono elaborate in modo sicuro. Non archiviamo i dettagli della carta di credito né abbiamo accesso alle informazioni sulla tua carta di credito.
Indagine
Potrebbe piacerti anche
FAQ
Il prodotto è solo per scopi di ricerca e non è destinato all'uso terapeutico o diagnostico su esseri umani o animali. Prodotti e contenuti sono protetti da brevetti, marchi e copyright di proprietà di Yeasen Biotechnology. I simboli dei marchi indicano il paese di origine, non necessariamente la registrazione in tutte le regioni.
Alcune applicazioni potrebbero richiedere ulteriori diritti di proprietà intellettuale di terze parti.
Yeasen è un sostenitore della scienza etica, convinto che la nostra ricerca debba affrontare questioni critiche garantendo al contempo sicurezza e standard etici.