Descrizione
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
Pagamento e sicurezza
Le informazioni di pagamento vengono elaborate in modo sicuro. Non archiviamo i dettagli della carta di credito né abbiamo accesso alle informazioni sulla tua carta di credito.
Indagine
Potrebbe piacerti anche
FAQ
Il prodotto è solo per scopi di ricerca e non è destinato all'uso terapeutico o diagnostico su esseri umani o animali. Prodotti e contenuti sono protetti da brevetti, marchi e copyright di proprietà di Yeasen Biotechnology. I simboli dei marchi indicano il paese di origine, non necessariamente la registrazione in tutte le regioni.
Alcune applicazioni potrebbero richiedere ulteriori diritti di proprietà intellettuale di terze parti.
Yeasen è un sostenitore della scienza etica, convinto che la nostra ricerca debba affrontare questioni critiche garantendo al contempo sicurezza e standard etici.

