Keterangan
Galectin-4 (Gal-4), a member of the galectin family, is a tandem-repeat-type galectin featuring two carbohydrate recognition domains (CRDs) on a single polypeptide chain, connected by a linker region. These CRDs are responsible for binding β-galactosides. Several binding partners for Gal-4 have been identified, including human blood group antigens, glycoproteins, the mucin-like membrane protein MUC1, glycosphingolipids, and sulfated cholesterol. Gal-4 is constitutively expressed in the intestine and stomach, uterine epithelial cells, vascular walls, as well as hippocampal and cortical neurons. It plays a crucial role in various biological processes, including lipid raft stabilization, apical protein transport, cell adhesion, wound healing, intestinal inflammation, and host defense.
Specifications
|
Cat.No. |
92309ES08 / 92309ES20 / 92309ES60 / 92309ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92309ES08 |
92309ES20 |
92309ES60 |
92309ES76 |
|
HiActi™ Recombinant Human Galectin-4 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
LGALS4, GAL4, L36LBP |
|
Species |
Human |
|
Expression Sequence |
AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI with polyhistidine tag at the N-terminus. |
|
Accession |
P56470 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 36.8 kDa. The protein migrates as 37 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to chemoattract human THP1 cells using a concentration range of 0.5-2.5 µg/mL. |
|
Reconstitution Instructions |
1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves, for your safety.
Documents
Safety Data Sheet
Manuals:
Pembayaran & Keamanan
Informasi pembayaran Anda diproses dengan aman. Kami tidak menyimpan detail kartu kredit atau memiliki akses ke informasi kartu kredit Anda.
Anda mungkin juga menyukai
Pertanyaan
FAQ
Produk ini hanya untuk keperluan penelitian dan tidak ditujukan untuk penggunaan terapeutik atau diagnostik pada manusia atau hewan. Produk dan konten dilindungi oleh paten, merek dagang, dan hak cipta milik
Aplikasi tertentu mungkin memerlukan hak kekayaan intelektual pihak ketiga tambahan.

