Keterangan
Fibroblast growth factor-14 (FGF-14) is a member of the fibroblast growth factor family with a molecular weight of 27.7 kDa and contains 247 amino acid residues. FGF-14 is primarily expressed in the brain and cervix. It is involved in the development and function of the nervous system, and may regulate the trafficking and function of voltage-gated sodium channels.
Specifications
|
Cat.No. |
91354ES08 / 91354ES20 / 91354ES60 / 91354ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
91354ES08 |
91354ES20 |
91354ES60 |
91354ES76 |
|
HiActi™ Recombinant Human FGF-14 Protein ,His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
fibroblast growth factor 14, FHF-4, FHF4, SCA27, FGF14 |
|
Species |
Human |
|
Expression Sequence |
AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with polyhistidine tag at the N-terminus. |
|
Accession |
Q92915 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 28.28 kDa. The protein migrates as 33 kDa under reducing condition. |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <21 ng/mL. |
|
Reconstitution Instructions |
1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves, for your safety.
Documents
Safety Data Sheet
Manuals:
Pembayaran & Keamanan
Informasi pembayaran Anda diproses dengan aman. Kami tidak menyimpan detail kartu kredit atau memiliki akses ke informasi kartu kredit Anda.
Anda mungkin juga menyukai
Pertanyaan
FAQ
Produk ini hanya untuk keperluan penelitian dan tidak ditujukan untuk penggunaan terapeutik atau diagnostik pada manusia atau hewan. Produk dan konten dilindungi oleh paten, merek dagang, dan hak cipta milik
Aplikasi tertentu mungkin memerlukan hak kekayaan intelektual pihak ketiga tambahan.

