विवरण
BMP-4 is a key member of the TGF-β superfamily and plays critical roles in embryonic development, cell differentiation, tissue homeostasis, and disease. Initially identified for its ability to induce bone and cartilage formation, BMP-4 is now known to regulate the development and function of multiple organ systems.
BMP-4 signals by binding to type I and type II serine/threonine kinase receptors (BMPR-I/II) on the cell surface, activating downstream SMAD-dependent and -independent pathways. During embryogenesis, it drives the differentiation of mesoderm-derived tissues, including hematopoietic and renal lineages. BMP-4 also promotes osteogenic differentiation of mesenchymal stem cells, supports bone repair, maintains hematopoietic stem cell self-renewal, and inhibits preadipocyte differentiation.
This recombinant human BMP-4 is expressed in E. coli, supplied in liquid format, and characterized by high purity, high bioactivity, and low endotoxin levels—making it ideal for research applications in stem cell biology, developmental studies, and regenerative medicine.
Components
|
Components No. |
Name |
92070ES05 |
92070ES10 |
92070ES50 |
92070ES72 |
92070ES76 |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
2 μg |
10 μg |
50 μg |
250 μg |
500 μg |
Specifications
|
Components No. |
Name |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
|
Protein Synonyms |
BMP2B ; BMP2B1; DVR4; MCOPS6; OFC11 ; ZYME |
|
Species |
Human |
|
Expression System |
E.coli |
|
Expression Sequence |
MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTN HAIVQTLVNSVNSSIP KACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH |
|
Accession |
P12644 |
|
Tag |
C-His |
|
Endotoxin |
< 1.0 EU per 1 μg of the protein by the LAL method |
|
Purity |
> 95%, determined by SDS-PAGE |
|
Activity |
The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. |
Storage
This product should be stored at -25~-15℃ for 1 year. Avoid repeated freeze–thaw cycles. Centrifuge briefly before opening the vial. It is recommended to aliquot the reagent into single-use portions.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves，for your safety.
Figure
1. Purity
Figure 1. Human BMP-4 on SDS-PAGE under reduced and non-reduced conditions. The purity is greater than 95%.
2. Cell Based Assay
Figure 2. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL.
Documents:
Safety Data Sheet
Manuals
भुगतान और सुरक्षा
आपकी भुगतान जानकारी सुरक्षित रूप से संसाधित की जाती है। हम क्रेडिट कार्ड के विवरण को संग्रहीत नहीं करते हैं और न ही आपके क्रेडिट कार्ड की जानकारी तक पहुंच है।
जाँच करना
आपको यह भी पसंद आ सकता हैं
उपवास
यह उत्पाद केवल शोध उद्देश्यों के लिए है और मनुष्यों या जानवरों में चिकित्सीय या नैदानिक उपयोग के लिए अभिप्रेत नहीं है। उत्पाद और सामग्री येसेन बायोटेक्नोलॉजी के स्वामित्व वाले पेटेंट, ट्रेडमार्क और कॉपीराइट द्वारा संरक्षित हैं। ट्रेडमार्क प्रतीक मूल देश को इंगित करते हैं, जरूरी नहीं कि सभी क्षेत्रों में पंजीकरण हो।
कुछ अनुप्रयोगों के लिए अतिरिक्त तृतीय-पक्ष बौद्धिक संपदा अधिकारों की आवश्यकता हो सकती है।
येसेन नैतिक विज्ञान के प्रति समर्पित हैं, उनका मानना है कि हमारे शोध में सुरक्षा और नैतिक मानकों को सुनिश्चित करते हुए महत्वपूर्ण प्रश्नों का समाधान किया जाना चाहिए।