विवरण
Interleukin-12 (IL-12) is a pro-inflammatory cytokine with a molecular weight of 70 kDa, composed of two subunits: IL-12p35 (35 kDa) and IL-12p40 (40 kDa). IL-12p40 is induced to a greater extent than other subunits of IL-12 and IL-23, and can exist as a monomer or a homodimer.
Specifications
|
Cat.No. |
90291ES08 / 90291ES20 / 90291ES60 / 90291ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
90291ES08 |
90291ES20 |
90291ES60 |
90291ES76 |
|
HiActi™ Recombinant Human IL-12 p40 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interleukin 12 p40, Interleukin-12 subunit beta, IL-12 |
|
Species |
Human |
|
Expression Sequence |
MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS with polyhistidine tag at the C-terminus. |
|
Accession |
P29460 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 35.64 kDa. The protein migrates as 45 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce cell proliferation in PHA-activated human peripheral blood lymphocytes (PBMC) using a concentration range of 5-50 ng/mL. Note: Results may vary from different PBMC donors. |
|
Reconstitution Instructions |
1. Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents
Safety Data Sheet
Manuals:
भुगतान और सुरक्षा
आपकी भुगतान जानकारी सुरक्षित रूप से संसाधित की जाती है। हम क्रेडिट कार्ड के विवरण को संग्रहीत नहीं करते हैं और न ही आपके क्रेडिट कार्ड की जानकारी तक पहुंच है।
आपको यह भी पसंद आ सकता हैं
जाँच करना
उपवास
यह उत्पाद केवल शोध उद्देश्यों के लिए है और मनुष्यों या जानवरों में चिकित्सीय या नैदानिक उपयोग के लिए अभिप्रेत नहीं है। उत्पाद और सामग्री येसेन बायोटेक्नोलॉजी के स्वामित्व वाले पेटेंट, ट्रेडमार्क और कॉपीराइट द्वारा संरक्षित हैं। ट्रेडमार्क प्रतीक मूल देश को इंगित करते हैं, जरूरी नहीं कि सभी क्षेत्रों में पंजीकरण हो।
कुछ अनुप्रयोगों के लिए अतिरिक्त तृतीय-पक्ष बौद्धिक संपदा अधिकारों की आवश्यकता हो सकती है।
येसेन नैतिक विज्ञान के प्रति समर्पित हैं, उनका मानना है कि हमारे शोध में सुरक्षा और नैतिक मानकों को सुनिश्चित करते हुए महत्वपूर्ण प्रश्नों का समाधान किया जाना चाहिए।

