विवरण
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
भुगतान और सुरक्षा
आपकी भुगतान जानकारी सुरक्षित रूप से संसाधित की जाती है। हम क्रेडिट कार्ड के विवरण को संग्रहीत नहीं करते हैं और न ही आपके क्रेडिट कार्ड की जानकारी तक पहुंच है।
जाँच करना
आपको यह भी पसंद आ सकता हैं
उपवास
यह उत्पाद केवल शोध उद्देश्यों के लिए है और मनुष्यों या जानवरों में चिकित्सीय या नैदानिक उपयोग के लिए अभिप्रेत नहीं है। उत्पाद और सामग्री येसेन बायोटेक्नोलॉजी के स्वामित्व वाले पेटेंट, ट्रेडमार्क और कॉपीराइट द्वारा संरक्षित हैं। ट्रेडमार्क प्रतीक मूल देश को इंगित करते हैं, जरूरी नहीं कि सभी क्षेत्रों में पंजीकरण हो।
कुछ अनुप्रयोगों के लिए अतिरिक्त तृतीय-पक्ष बौद्धिक संपदा अधिकारों की आवश्यकता हो सकती है।
येसेन नैतिक विज्ञान के प्रति समर्पित हैं, उनका मानना है कि हमारे शोध में सुरक्षा और नैतिक मानकों को सुनिश्चित करते हुए महत्वपूर्ण प्रश्नों का समाधान किया जाना चाहिए।