Frequently Bought Together
Galectin-16 (Gal-16) is a member of the galectin family and one of the prototype galectins; however, it exists as a monomer and exhibits significant differences from other prototype galectins in β-galactoside binding. Like galectin-13 and galectin-14, galectin-16 is expressed in the placenta, where it participates in T-cell apoptosis, immune regulation, and immune tolerance, making it essential for fetal development. The molecular mechanism by which galectin-16 forms a complex with c-Rel has been elucidated, suggesting that galectin-16 activates signal transduction pathways via the c-Rel hub in B cells or T cells at the maternal-fetal interface.
Specifications
|
Cat.No. |
92316ES08 / 92316ES20 / 92316ES60 / 92316ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92316ES08 |
92316ES20 |
92316ES60 |
92316ES76 |
|
HiActi™ Recombinant Human Galectin-16 Protein,His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
LGALS16 |
|
Species |
Human |
|
Expression Sequence |
SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR with polyhistidine tag at the N-terminus. |
|
Accession |
A8MUM7 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 17.4 kDa. The protein migrates as 18 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Storage
FAQ
Citations
Documents
Applications
También te puede gustar
Consulta
Preguntas frecuentes
El producto es solo para fines de investigación y no está destinado a uso terapéutico o diagnóstico en humanos o animales. Los productos y el contenido están protegidos por patentes, marcas comerciales y derechos de autor propiedad de Yeasen Biotechnology. Los símbolos de marca comercial indican el país de origen, no necesariamente el registro en todas las regiones.
Algunas aplicaciones pueden requerir derechos de propiedad intelectual adicionales de terceros.
Yeasen se dedica a la ciencia ética y cree que nuestra investigación debe abordar cuestiones críticas al tiempo que garantiza la seguridad y los estándares éticos.

