Descripción
Interleukin-1α (IL-1α), also known as hematopoietin-1, is a cytokine with a molecular weight of 17.65 kDa, comprising 159 amino acid residues. IL-1α is primarily expressed in macrophages, neutrophils, epithelial cells, and endothelial cells. Upon binding to the IL-1 receptor, it mediates various biological processes, such as cell proliferation, angiogenesis, interleukin-2 production, and cellular sodium homeostasis. Furthermore, IL-1α plays a critical role in immune responses, including fever and inflammation, and induces tumor necrosis factor-α (TNF-α).
Specifications
|
Cat.No. |
90301ES08 / 90301ES20 |
|
Size |
5 μg / 20 μg |
Components
|
Name |
90301ES08 |
90301ES20 |
|
HiActi™ Recombinant Porcine IL-1 alpha Protein, His Tag |
5 μg |
20 μg |
Performance parameters
|
Synonyms |
interleukin 1 alpha, IL1A |
|
Species |
Porcine |
|
Expression Sequence |
MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS with polyhistidine tag at the C-terminus. |
|
Accession |
P18430 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀ for this effect is <50 pg/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Pago y seguridad
Su información de pago se procesa de forma segura. No almacenamos detalles de la tarjeta de crédito ni tenemos acceso a la información de su tarjeta de crédito.
También te puede gustar
Consulta
Preguntas frecuentes
El producto es solo para fines de investigación y no está destinado a uso terapéutico o diagnóstico en humanos o animales. Los productos y el contenido están protegidos por patentes, marcas comerciales y derechos de autor propiedad de Yeasen Biotechnology. Los símbolos de marca comercial indican el país de origen, no necesariamente el registro en todas las regiones.
Algunas aplicaciones pueden requerir derechos de propiedad intelectual adicionales de terceros.
Yeasen se dedica a la ciencia ética y cree que nuestra investigación debe abordar cuestiones críticas al tiempo que garantiza la seguridad y los estándares éticos.