Descripción
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
Pago y seguridad
Su información de pago se procesa de forma segura. No almacenamos detalles de la tarjeta de crédito ni tenemos acceso a la información de su tarjeta de crédito.
También te puede gustar
Consulta
Preguntas frecuentes
El producto es solo para fines de investigación y no está destinado a uso terapéutico o diagnóstico en humanos o animales. Los productos y el contenido están protegidos por patentes, marcas comerciales y derechos de autor propiedad de Yeasen Biotechnology. Los símbolos de marca comercial indican el país de origen, no necesariamente el registro en todas las regiones.
Algunas aplicaciones pueden requerir derechos de propiedad intelectual adicionales de terceros.
Yeasen se dedica a la ciencia ética y cree que nuestra investigación debe abordar cuestiones críticas al tiempo que garantiza la seguridad y los estándares éticos.

