Beskrivelse
BMP-4 is a key member of the TGF-β superfamily and plays critical roles in embryonic development, cell differentiation, tissue homeostasis, and disease. Initially identified for its ability to induce bone and cartilage formation, BMP-4 is now known to regulate the development and function of multiple organ systems.
BMP-4 signals by binding to type I and type II serine/threonine kinase receptors (BMPR-I/II) on the cell surface, activating downstream SMAD-dependent and -independent pathways. During embryogenesis, it drives the differentiation of mesoderm-derived tissues, including hematopoietic and renal lineages. BMP-4 also promotes osteogenic differentiation of mesenchymal stem cells, supports bone repair, maintains hematopoietic stem cell self-renewal, and inhibits preadipocyte differentiation.
This recombinant human BMP-4 is expressed in E. coli, supplied in liquid format, and characterized by high purity, high bioactivity, and low endotoxin levels—making it ideal for research applications in stem cell biology, developmental studies, and regenerative medicine.
Components
|
Components No. |
Name |
92070ES05 |
92070ES10 |
92070ES50 |
92070ES72 |
92070ES76 |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
2 μg |
10 μg |
50 μg |
250 μg |
500 μg |
Specifications
|
Components No. |
Name |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
|
Protein Synonyms |
BMP2B ; BMP2B1; DVR4; MCOPS6; OFC11 ; ZYME |
|
Species |
Human |
|
Expression System |
E.coli |
|
Expression Sequence |
MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTN HAIVQTLVNSVNSSIP KACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH |
|
Accession |
P12644 |
|
Tag |
C-His |
|
Endotoxin |
< 1.0 EU per 1 μg of the protein by the LAL method |
|
Purity |
> 95%, determined by SDS-PAGE |
|
Activity |
The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. |
Storage
This product should be stored at -25~-15℃ for 1 year. Avoid repeated freeze–thaw cycles. Centrifuge briefly before opening the vial. It is recommended to aliquot the reagent into single-use portions.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Figure
1. Purity

Figure 1. Human BMP-4 on SDS-PAGE under reduced and non-reduced conditions. The purity is greater than 95%.
2. Cell Based Assay

Figure 2. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL.
Documents:
Safety Data Sheet
Manuals
Betaling og sikkerhed
Dine betalingsoplysninger behandles sikkert. Vi gemmer ikke kreditkortoplysninger og har heller ikke adgang til dine kreditkortoplysninger.
Forespørgsel
Du kan også lide
FAQ
Produktet er kun til forskningsformål og er ikke beregnet til terapeutisk eller diagnostisk brug hos mennesker eller dyr. Produkter og indhold er beskyttet af patenter, varemærker og ophavsrettigheder ejet af Yeasen Biotechnology. Varemærkesymboler angiver oprindelseslandet, ikke nødvendigvis registrering i alle regioner.
Visse applikationer kan kræve yderligere tredjeparts intellektuelle ejendomsrettigheder.
Yeasen er dedikeret til etisk videnskab og mener, at vores forskning bør adressere kritiske spørgsmål og samtidig sikre sikkerhed og etiske standarder.

