Описание
Interleukin-6 (IL-6) is a pleiotropic cytokine that plays a crucial role in the acute-phase response, inflammation, bone metabolism, lymphocyte differentiation, and cancer progression. Dysregulation of IL-6 production is also implicated in various diseases, including rheumatoid arthritis, Alzheimer's disease, autoimmune disorders, and different types of cancer.
Specifications
|
Cat.No. |
90303ES08 |
|
Size |
5 μg |
Components
|
Name |
90303ES08 |
|
HiActi™ Recombinant Porcine IL-6 Protein, His Tag |
5 μg |
Performance parameters
|
Synonyms |
interleukin 6, IL6 |
|
Species |
Porcine |
|
Expression Sequence |
MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM with polyhistidine tag at the C-terminus. |
|
Accession |
P26893 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 21.9 kDa. The protein migrates as 23 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED₅₀ for this effect is <1.5 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 ~ 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Оплата и безопасность
Ваша платежная информация обрабатывается надежно. Мы не храним данные кредитной карты и не имеем доступа к информации вашей кредитной карты.
Вам также может понравиться
Расследование
Часто задаваемые вопросы
Продукт предназначен только для исследовательских целей и не предназначен для терапевтического или диагностического использования на людях или животных. Продукты и содержимое защищены патентами, товарными знаками и авторскими правами, принадлежащими Yeasen Biotechnology. Символы товарных знаков указывают на страну происхождения, а не обязательно на регистрацию во всех регионах.
Для некоторых приложений могут потребоваться дополнительные права интеллектуальной собственности третьих лиц.
Йесен привержен этической науке, полагая, что наши исследования должны затрагивать важнейшие вопросы, обеспечивая при этом безопасность и соблюдение этических стандартов.

