Описание
Interleukin 38 (IL-38) belongs to the IL-1 family and is expressed in fetal skin, spleen, and tonsils, predominantly in the basal epithelium of the skin and in proliferating B cells of the tonsils.IL-38 binds soluble IL-1 receptor type 1 and may be involved in the modulation of adaptive and innate immune responses. Alone, it does not induce cytokine production but decreases T-cell production of heat-inactivated Candida albicans IL22 and IL17A.IL-38 decreases IL36γ -induced IL8 production by peripheral blood mononuclear cells and increases IL6 production by bacterial lipopolysaccharide (LPS)-stimulated dendritic cells.
Recombinant Human IL-38 is a 16.9 kDa protein containing 152 amino acid residues. This Recombinant Human IL-38 is supplied as Lyophilized powder with high activity, high purity, low endotoxin, and NO labeling.
Product Properties
|
Synonyms |
Interleukin-38, Interleukin 1 family member 10, IL1F10, FIL1-theta, FKSG75, IL-1HY2, IL1-theta |
|
Source |
E.coli-derived human IL-38 protein, Met1-Trp152. |
|
Accession |
Q8WWZ1 |
|
Molecular Weight |
Approximately 16.9kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
|
AA Sequence |
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW |
|
Endotoxin |
< 0.01 EU/μg by the LAL method. |
|
Purity |
> 97% by SDS-PAGE and HPLC |
|
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0. |
|
Physical Appearance |
Lyophilized powder |
|
Tag |
NO |
Shipping and Storage
-25 ~ -15 ° C storage, 1 year expiration date after receipt.
After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.
Compounding method
Centrifuge before uncapping to bring contents to the bottom. Reconstitute in NO bacterial distilled water to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long term storage, it is recommended that carrier protein (0.1% BSA) be added to the rehydration buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing.
Cautions
1. For your safety and health, please wear lab coat and disposable gloves.
2. This product is for scientific research purposes only.
Оплата и безопасность
Ваша платежная информация обрабатывается надежно. Мы не храним данные кредитной карты и не имеем доступа к информации вашей кредитной карты.
Расследование
Вам также может понравиться
Часто задаваемые вопросы
Продукт предназначен только для исследовательских целей и не предназначен для терапевтического или диагностического использования на людях или животных. Продукты и содержимое защищены патентами, товарными знаками и авторскими правами, принадлежащими Yeasen Biotechnology. Символы товарных знаков указывают на страну происхождения, а не обязательно на регистрацию во всех регионах.
Для некоторых приложений могут потребоваться дополнительные права интеллектуальной собственности третьих лиц.
Йесен привержен этической науке, полагая, что наши исследования должны затрагивать важнейшие вопросы, обеспечивая при этом безопасность и соблюдение этических стандартов.

