Beschrijving
Neurturin is a cytokine with a molecular weight of 22 kDa, consisting of 195 amino acid residues. Along with GDNF, it belongs to the glial cell line-derived neurotrophic factor (GDNF) family. Neurturin binds to GFRα-2 (a GPI-anchored receptor known as GDNF family receptor alpha-2), thereby activating the Ret receptor tyrosine kinase and the MAPK signaling pathway. It plays a crucial role in neuronal survival.
Specifications
|
Cat.No. |
92137ES08 / 92137ES20 / 92137ES60 / 92137ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92137ES08 |
92137ES20 |
92137ES60 |
92137ES76 |
|
HiActi™ Recombinant Mouse Neurturin Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
NTN, NRTN |
|
Species |
Mouse |
|
Expression Sequence |
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV with polyhistidine tag at the N-terminus. |
|
Accession |
P97463 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 12.33 kDa. The protein migrates as 11-17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Betaling en beveiliging
Uw betalingsinformatie wordt veilig verwerkt. We slaan geen creditcardgegevens op en hebben geen toegang tot uw creditcardinformatie.
Misschien vind je het ook leuk
Navraag
FAQ
Het product is alleen bedoeld voor onderzoeksdoeleinden en is niet bedoeld voor therapeutisch of diagnostisch gebruik bij mensen of dieren. Producten en inhoud worden beschermd door patenten, handelsmerken en auteursrechten die eigendom zijn van
Voor bepaalde toepassingen zijn mogelijk aanvullende intellectuele eigendomsrechten van derden vereist.