Frequently Bought Together
Activin B is a cytokine belonging to the transforming growth factor-beta (TGFβ) family. It is a protein with a molecular weight of 12.9 kDa and consists of 116 amino acid residues. Activin B exhibits a wide range of biological functions, including stem cell differentiation, inflammation, bone remodeling, and neurodevelopment. It is also involved in regulating the secretion of follicle-stimulating hormone (FSH). Furthermore, Activin B induces the phosphorylation of Smad proteins and their binding to Smad-binding elements.
Specifications
|
Cat.No. |
91712ES08 / 91712ES20 / 91712ES60 / 91712ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 100 μg |
Components
|
Name |
91712ES08 |
91712ES20 |
91712ES60 |
91712ES76 |
|
HiActi™ Recombinant Mouse Activin B Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
Activin Beta B; Activin beta-B chain; INHBB; inhibin beta B |
|
Species |
Mouse |
|
Expression Sequence |
MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus. |
|
Accession |
Q04999 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 13.71 kDa. The protein migrates about 17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce hemoglobin expression in K562 cells. The ED₅₀ for this effect is <1 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Storage
FAQ
Citations
Documents
Applications
Misschien vind je het ook leuk
Navraag
FAQ
Het product is alleen bedoeld voor onderzoeksdoeleinden en is niet bedoeld voor therapeutisch of diagnostisch gebruik bij mensen of dieren. Producten en inhoud worden beschermd door patenten, handelsmerken en auteursrechten die eigendom zijn van
Voor bepaalde toepassingen zijn mogelijk aanvullende intellectuele eigendomsrechten van derden vereist.

