Beschreibung
Neurturin is a cytokine with a molecular weight of 22 kDa, consisting of 195 amino acid residues. Along with GDNF, it belongs to the glial cell line-derived neurotrophic factor (GDNF) family. Neurturin binds to GFRα-2 (a GPI-anchored receptor known as GDNF family receptor alpha-2), thereby activating the Ret receptor tyrosine kinase and the MAPK signaling pathway. It plays a crucial role in neuronal survival.
Specifications
|
Cat.No. |
92137ES08 / 92137ES20 / 92137ES60 / 92137ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
92137ES08 |
92137ES20 |
92137ES60 |
92137ES76 |
|
HiActi™ Recombinant Mouse Neurturin Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
NTN, NRTN |
|
Species |
Mouse |
|
Expression Sequence |
PGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV with polyhistidine tag at the N-terminus. |
|
Accession |
P97463 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 12.33 kDa. The protein migrates as 11-17 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Zahlung und Sicherheit
Ihre Zahlungsinformationen werden sicher verarbeitet. Wir speichern weder Kreditkartendaten noch Zugriff auf Ihre Kreditkarteninformationen.
Sie können auch mögen
Anfrage
FAQ
Das Produkt ist nur für Forschungszwecke bestimmt und nicht für die therapeutische oder diagnostische Anwendung bei Menschen oder Tieren. Produkte und Inhalte sind durch Patente, Marken und Urheberrechte von
Für bestimmte Anwendungen sind möglicherweise zusätzliche geistige Eigentumsrechte Dritter erforderlich.