Beschreibung
The fibroblast growth factor (FGF) family comprises two classes: secreted FGFs and intracellular FGFs (iFGFs). iFGFs are associated with voltage-gated sodium channels (Nav). Human FGF-11 isoform 2 is a cytokine with a molecular weight of 18 kDa and contains 166 amino acid residues.
Specifications
|
Cat.No. |
91353ES08 / 91353ES20 / 91353ES60 / 91353ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
91353ES08 |
91353ES20 |
91353ES60 |
91353ES76 |
|
HiActi™ Recombinant Human FGF-11 isoform 2 Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
fibroblast growth factor 11 isoform 2, FHF-3, FHF3, FGF11 |
|
Species |
Human |
|
Expression Sequence |
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP with polyhistidine tag at the C-terminus. |
|
Accession |
Q92914 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 19.34 kDa. The protein migrates as 23 kDa under reducing condition. |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. |
|
Reconstitution Instructions |
1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves, for your safety.
Documents
Manuals:
Zahlung und Sicherheit
Ihre Zahlungsinformationen werden sicher verarbeitet. Wir speichern weder Kreditkartendaten noch Zugriff auf Ihre Kreditkarteninformationen.
Sie können auch mögen
Anfrage
FAQ
Das Produkt ist nur für Forschungszwecke bestimmt und nicht für die therapeutische oder diagnostische Anwendung bei Menschen oder Tieren. Produkte und Inhalte sind durch Patente, Marken und Urheberrechte von
Für bestimmte Anwendungen sind möglicherweise zusätzliche geistige Eigentumsrechte Dritter erforderlich.

