Sự miêu tả
The predicted molecular weight of Interleukin-28A (IL-28A) is 22.3 kDa. There are two isoforms of IL-28: IL-28A and IL-28B, which play a role in antiviral immune defense. This includes inducing an "antiviral state" by activating Mx proteins, 2',5'-oligoadenylate synthetase, and ISGF3G.
Specifications
|
Cat.No. |
90293ES08 / 90293ES20 / 90293ES60 / 90293ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
90293ES08 |
90293ES20 |
90293ES60 |
90293ES76 |
|
HiActi™ Recombinant Mouse IL-28A Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interleukin 28A, IFN-λ2, IL28, IL28A |
|
Species |
Mouse |
|
Expression Sequence |
MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV with polyhistidine tag at the C-terminus. |
|
Accession |
AAX58714.1 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 20.61 kDa. The protein migrates as 17-25 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <2 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Thanh toán & Bảo mật
Thông tin thanh toán của bạn được xử lý an toàn. Chúng tôi không lưu trữ chi tiết thẻ tín dụng cũng như không có quyền truy cập vào thông tin thẻ tín dụng của bạn.
Bạn cũng có thể thích
Cuộc điều tra
Câu hỏi thường gặp
Sản phẩm chỉ dành cho mục đích nghiên cứu và không dùng để điều trị hoặc chẩn đoán ở người hoặc động vật. Sản phẩm và nội dung được bảo vệ bởi các bằng sáng chế, nhãn hiệu và bản quyền thuộc sở hữu của
Một số ứng dụng có thể yêu cầu thêm quyền sở hữu trí tuệ của bên thứ ba.

