Protein IL-38 của con người _ 90219es

YeasenSKU: 90219ES05

Kích cỡ: 2 ug
Giá:
Giá bán$70.00

Vận chuyển được tính toán khi thanh toán

Cổ phần:
Trong kho

Sự miêu tả

Interleukin 38 (IL-38) belongs to the IL-1 family and is expressed in fetal skin, spleen, and tonsils, predominantly in the basal epithelium of the skin and in proliferating B cells of the tonsils.IL-38 binds soluble IL-1 receptor type 1 and may be involved in the modulation of adaptive and innate immune responses. Alone, it does not induce cytokine production but decreases T-cell production of heat-inactivated Candida albicans IL22 and IL17A.IL-38 decreases IL36γ -induced IL8 production by peripheral blood mononuclear cells and increases IL6 production by bacterial lipopolysaccharide (LPS)-stimulated dendritic cells.

Recombinant Human IL-38 is a 16.9 kDa protein containing 152 amino acid residues. This Recombinant Human IL-38 is supplied as Lyophilized powder with high activity, high purity, low endotoxin, and NO labeling. 

Product Properties

Synonyms

Interleukin-38, Interleukin 1 family member 10, IL1F10, FIL1-theta, FKSG75, IL-1HY2, IL1-theta

Source

E.coli-derived human IL-38 protein, Met1-Trp152.

Accession

Q8WWZ1

Molecular Weight

Approximately 16.9kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. 

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Endotoxin

< 0.01 EU/μg by the LAL method.

Purity

> 97% by SDS-PAGE and HPLC

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.

Physical Appearance

Lyophilized powder

Tag

NO

Shipping and Storage

-25 ~ -15 ° C storage, 1 year expiration date after receipt.

After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.

Compounding method

Centrifuge before uncapping to bring contents to the bottom. Reconstitute in NO bacterial distilled water to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long term storage, it is recommended that carrier protein (0.1% BSA) be added to the rehydration buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing. 

Cautions

1. For your safety and health, please wear lab coat and disposable gloves.

2. This product is for scientific research purposes only.

Thanh toán & Bảo mật

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

Thông tin thanh toán của bạn được xử lý an toàn. Chúng tôi không lưu trữ chi tiết thẻ tín dụng cũng như không có quyền truy cập vào thông tin thẻ tín dụng của bạn.

Bạn cũng có thể thích

Cuộc điều tra

Câu hỏi thường gặp

Sản phẩm chỉ dành cho mục đích nghiên cứu và không dùng để điều trị hoặc chẩn đoán ở người hoặc động vật. Sản phẩm và nội dung được bảo vệ bởi các bằng sáng chế, nhãn hiệu và bản quyền thuộc sở hữu của Yeasen Công nghệ sinh học. Biểu tượng nhãn hiệu chỉ ra quốc gia xuất xứ, không nhất thiết phải đăng ký ở tất cả các khu vực.

Một số ứng dụng có thể yêu cầu thêm quyền sở hữu trí tuệ của bên thứ ba.

Yeasen dành riêng cho khoa học đạo đức, tin rằng nghiên cứu của chúng tôi phải giải quyết các vấn đề quan trọng đồng thời đảm bảo các tiêu chuẩn về an toàn và đạo đức.