Recombinant Alkalitolerant Protein A (Freeze-Dried) _ 20543ES
Cuộn hình ảnh để phóng to Bấm vào hình ảnh để phóng to
Recombinant Alkalitolerant Protein A (Freeze-Dried) _ 20543ES

Recombinant Alkalitolerant Protein A (Freeze-Dried) _ 20543ES

YeasenSKU: 20543ES10
Size: 10 mg
Giá:
$90.00

Vận chuyển được tính toán khi thanh toán

Cổ phần:
Trong kho
Bulk Quotation and Samples Inquiry

Sự miêu tả

Protein A is a cell wall component produced by several strains of Staphylococcus aureus, consisting of a polypeptide chain and containing almost no carbohydrates. This product is produced in Escherichia coli and functions similarly to natural protein A. It consists of five IgG binding domains E-D-A-B-C arranged in series, with strong specific affinity for the Fc fragment of IgG. Protein A, as an affinity ligand, is coupled to the matrix and can specifically bind to antibody molecules in the sample, allowing other impurities to flow through and exhibiting high selectivity. Commonly used for purification of monoclonal antibodies or polyclonal antibodies. Protein A binds to human, mouse, and rat IgG subclasses (e.g. human IgG1, IgG2, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2c), as 
well as total IgG from rabbits, guinea pigs, pigs, dogs, and cats.

Components

Components No.

Name

20543ES10

20543ES60

20543

RNase A  (10 mg/mL)

10 mg

100  mg

Product Properties

Synonyms

Recombinant protein A alkali-tolerant

Source

E.coli

 

Molecular Weight

Approximately 26.7 kDa, a single non-glycosylated polypeptide chain containing 237amino acids

 

 

 

Amino Acid Sequence

AQGTVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLND

AQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLN  DAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKL  NDAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPKC

Concentration for  1  unity  OD at 280 nm

 

4.4 mg/mL

Physical Appearance

> 97 % by SDS-PAGE and HPLC analyses.

Purity

> 97% by SDS-PAGE and HPLC analyses.

Endotoxin Level

<0.1 EU /1 μg of the protein by the LAL method.

 

Formulation

A 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4 or lyophilized from a 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4

Reconstitution

Dissolve in distilled water or saline.

Storage

This product should be stored at -25~ -15℃, valid for 12 months. Avoid repeated freeze-thaw cycles.

Notes

1. Please operate with lab coats and disposable gloves ，for your safety.

2. This product is for research use only.

Appendix

Table 1. Summary of Binding Abilities of Proteins A, G, and L to Ig from Different Species

Table 1. Summary of&nbsp;Binding Abilities of&nbsp;Proteins&nbsp;A,&nbsp;G,&nbsp;and&nbsp;L&nbsp;to&nbsp;Ig&nbsp;from&nbsp;Different&nbsp;Species

Documents:

Safety Data Sheet

20543-MSDS-HB250701

Manuals

20543-Manual-Ver.EN20250701

Thanh toán & Bảo mật

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

Thông tin thanh toán của bạn được xử lý an toàn. Chúng tôi không lưu trữ chi tiết thẻ tín dụng cũng như không có quyền truy cập vào thông tin thẻ tín dụng của bạn.

Cuộc điều tra

Bạn cũng có thể thích

Câu hỏi thường gặp

Sản phẩm chỉ dành cho mục đích nghiên cứu và không dùng để điều trị hoặc chẩn đoán ở người hoặc động vật. Sản phẩm và nội dung được bảo vệ bởi các bằng sáng chế, nhãn hiệu và bản quyền thuộc sở hữu của Yeasen Công nghệ sinh học. Biểu tượng nhãn hiệu chỉ ra quốc gia xuất xứ, không nhất thiết phải đăng ký ở tất cả các khu vực.

Một số ứng dụng có thể yêu cầu thêm quyền sở hữu trí tuệ của bên thứ ba.

Yeasen dành riêng cho khoa học đạo đức, tin rằng nghiên cứu của chúng tôi phải giải quyết các vấn đề quan trọng đồng thời đảm bảo các tiêu chuẩn về an toàn và đạo đức.