Semaglutide intermediate P29-Arg34GLP-1(9-37)(Powder) _ 20381ES

YeasenSKU: 20381ES01

Size: 100 mg
Giá:
Giá bán$45.00

Vận chuyển được tính toán khi thanh toán

Cổ phần:
Trong kho

Sự miêu tả

Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.

This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.

Features

Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.

Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.

High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.

Components

Name

20381ES01

20381ES03 

20381ES08

20381ES25 

20381ES60

Leupeptin (Ultra Pure)

100 mg

1 g

5 g

25 g

100 g

Specifications

Cas No.

1169630-82-3

Peptide Sequence

EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH

Source

Expressed in E. coli

Molecular Weight

3175.5 ± 1.0 Da

Appearance

Lyophilized powder

Purity

≥95%

Storage

This product should be stored at -25~-15℃ for 2 years.

Notes

1. For your safety and health, wear a lab coat and disposable gloves while handling this product.

2. This product is intended for research use only.

Documents:

Safety Data Sheet

20381_MSDS_HB251022_EN.PDF

Manuals

20381_Manual_Ver.EN20251022.pdf

Thanh toán & Bảo mật

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

Thông tin thanh toán của bạn được xử lý an toàn. Chúng tôi không lưu trữ chi tiết thẻ tín dụng cũng như không có quyền truy cập vào thông tin thẻ tín dụng của bạn.

Cuộc điều tra

Bạn cũng có thể thích

Câu hỏi thường gặp

Sản phẩm chỉ dành cho mục đích nghiên cứu và không dùng để điều trị hoặc chẩn đoán ở người hoặc động vật. Sản phẩm và nội dung được bảo vệ bởi các bằng sáng chế, nhãn hiệu và bản quyền thuộc sở hữu của Yeasen Công nghệ sinh học. Biểu tượng nhãn hiệu chỉ ra quốc gia xuất xứ, không nhất thiết phải đăng ký ở tất cả các khu vực.

Một số ứng dụng có thể yêu cầu thêm quyền sở hữu trí tuệ của bên thứ ba.

Yeasen dành riêng cho khoa học đạo đức, tin rằng nghiên cứu của chúng tôi phải giải quyết các vấn đề quan trọng đồng thời đảm bảo các tiêu chuẩn về an toàn và đạo đức.