Sự miêu tả
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
Thanh toán & Bảo mật
Thông tin thanh toán của bạn được xử lý an toàn. Chúng tôi không lưu trữ chi tiết thẻ tín dụng cũng như không có quyền truy cập vào thông tin thẻ tín dụng của bạn.
Cuộc điều tra
Bạn cũng có thể thích
Câu hỏi thường gặp
Sản phẩm chỉ dành cho mục đích nghiên cứu và không dùng để điều trị hoặc chẩn đoán ở người hoặc động vật. Sản phẩm và nội dung được bảo vệ bởi các bằng sáng chế, nhãn hiệu và bản quyền thuộc sở hữu của
Một số ứng dụng có thể yêu cầu thêm quyền sở hữu trí tuệ của bên thứ ba.

