Описание
BMP-4 is a key member of the TGF-β superfamily and plays critical roles in embryonic development, cell differentiation, tissue homeostasis, and disease. Initially identified for its ability to induce bone and cartilage formation, BMP-4 is now known to regulate the development and function of multiple organ systems.
BMP-4 signals by binding to type I and type II serine/threonine kinase receptors (BMPR-I/II) on the cell surface, activating downstream SMAD-dependent and -independent pathways. During embryogenesis, it drives the differentiation of mesoderm-derived tissues, including hematopoietic and renal lineages. BMP-4 also promotes osteogenic differentiation of mesenchymal stem cells, supports bone repair, maintains hematopoietic stem cell self-renewal, and inhibits preadipocyte differentiation.
This recombinant human BMP-4 is expressed in E. coli, supplied in liquid format, and characterized by high purity, high bioactivity, and low endotoxin levels—making it ideal for research applications in stem cell biology, developmental studies, and regenerative medicine.
Components
|
Components No. |
Name |
92070ES05 |
92070ES10 |
92070ES50 |
92070ES72 |
92070ES76 |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
2 μg |
10 μg |
50 μg |
250 μg |
500 μg |
Specifications
|
Components No. |
Name |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
|
Protein Synonyms |
BMP2B ; BMP2B1; DVR4; MCOPS6; OFC11 ; ZYME |
|
Species |
Human |
|
Expression System |
E.coli |
|
Expression Sequence |
MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTN HAIVQTLVNSVNSSIP KACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH |
|
Accession |
P12644 |
|
Tag |
C-His |
|
Endotoxin |
< 1.0 EU per 1 μg of the protein by the LAL method |
|
Purity |
> 95%, determined by SDS-PAGE |
|
Activity |
The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. |
Storage
This product should be stored at -25~-15℃ for 1 year. Avoid repeated freeze–thaw cycles. Centrifuge briefly before opening the vial. It is recommended to aliquot the reagent into single-use portions.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Figure
1. Purity

Figure 1. Human BMP-4 on SDS-PAGE under reduced and non-reduced conditions. The purity is greater than 95%.
2. Cell Based Assay

Figure 2. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL.
Documents:
Safety Data Sheet
Manuals
Оплата и безопасность
Ваша платежная информация обрабатывается надежно. Мы не храним данные кредитной карты и не имеем доступа к информации вашей кредитной карты.
Расследование
Вам также может понравиться
Часто задаваемые вопросы
Продукт предназначен только для исследовательских целей и не предназначен для терапевтического или диагностического использования на людях или животных. Продукты и содержимое защищены патентами, товарными знаками и авторскими правами, принадлежащими Yeasen Biotechnology. Символы товарных знаков указывают на страну происхождения, а не обязательно на регистрацию во всех регионах.
Для некоторых приложений могут потребоваться дополнительные права интеллектуальной собственности третьих лиц.
Йесен привержен этической науке, полагая, что наши исследования должны затрагивать важнейшие вопросы, обеспечивая при этом безопасность и соблюдение этических стандартов.

