Recombinant Mouse BMP-4 Protein, His Tag _ 92056ES

YeasenSKU: 92056ES08

Size: 5 μg
Price:
Sale price$190.00

Shipping calculated at checkout

Stock:
In stock

Description

one morphogenetic protein (BMP) constitutes a subfamily of structurally related signaling proteins within the TGF-β superfamily. Members of this superfamily are widely distributed throughout the body and participate in various physiological processes both prenatally and postnatally. Similar to BMP-7, BMP-4 is also involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with many skeletal disorders, including genetic disorders such as fibrodysplasia ossificans progressiva. Mature mouse and human BMP-4 share 98% amino acid homology.

This product features high activity, high purity, and low endotoxin levels. The product's biological activity and batch-to-batch consistency are ensured through validation and testing of biological activity, endotoxin levels, and SDS-PAGE. Our product is provided in carrier-free form, making it suitable for cell culture, ELISA, or immunoblotting standard research and production.

Product Properties:

  • Alias: Bone Morphogenetic Protein 4; BMP4; BMP2B; BMP-2B; BMP2B1;
  • Uniprot No.: P21275
  • Expression System and Expression Range: E.coli-derived Mouse BMP-4 protein, Lys303-Arg408 with His tag at the C-terminus
  • Molecular Weight: Approximately 14 kDa.
  • Amino Acid Sequence:
    MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
  • Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
  • Purity: > 98% as determined by SDS-PAGE.
  • Biological Activity: Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10 ng/mL. The specific activity of recombinant mouse BMP-4 is > 1 x 10^5 IU/mg.
  • Endotoxin: < 0.1 EU per 1μg of the protein by the LAL method.
  • Formulation: Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 4.5.

Usage:

  1. Reconstitute the lyophilized powder with sterile water, with a solution concentration not less than 100 μg/mL, and let it stand for at least 20 minutes for complete dissolution.
  2. The reconstituted solution can be further diluted and aliquoted, with a shelf life of 1 month at 2-8°C and 3 months at -20°C; avoid repeated freeze-thaw cycles.
  3. When further diluting the reconstituted solution, add a certain amount of carrier protein (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experiments, it can be replaced with a 5% sucrose solution as a carrier.

Transportation and Storage:

Shipped on ice packs. Store at -20°C, with a shelf life of one year.

It is recommended to aliquot and store frozen for the first use to avoid repeated freeze-thaw cycles.

Precautions:

  1. For your safety and health, wear lab coats and disposable gloves during operation.
  2. This product is for research purposes only.

    Payment & Security

    American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

    Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.

    Inquiry

    You may also like

    FAQ

    The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.

    Certain applications may require additional third-party intellectual property rights.

    Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.