Description
Interleukin-17D (IL-17D) belongs to the IL-17 cytokine family and has a predicted molecular weight of 20 kDa. While the IL-17 family is closely associated with host defense and immune responses, IL-17D remains a novel cytokine that has not yet been extensively studied. It is abundantly secreted by fibrosarcoma tumor cells. Furthermore, ectopic expression of IL-17D in tumor cells can recruit natural killer cells by inducing the production of CCL2 in endothelial cells.
Specifications
|
Cat.No. |
90300ES08 / 90300ES20 / 90300ES60 / 90300ES76 |
|
Size |
5 μg / 20 μg / 100 μg / 500 μg |
Components
|
Name |
90300ES08 |
90300ES20 |
90300ES60 |
90300ES76 |
|
HiActi™ Recombinant Mouse IL-17D Protein, His Tag |
5 μg |
20 μg |
100 μg |
500 μg |
Performance parameters
|
Synonyms |
interleukin 17D, AI462269, IL17, IL17D |
|
Species |
Mouse |
|
Expression Sequence |
ALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAYCLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEPDKSAZDSANSSMDKLLLGPADRPAGR with polyhistidine tag at the N-terminus. |
|
Accession |
Q8K4C4 |
|
Tag |
N-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 20.74 kDa. The protein migrates about 25 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. |
|
Appearance |
Lyophilized Powder |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Payment & Security
Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.
You may also like
Inquiry
FAQ
The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.
Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.

