설명
BMP-4 is a key member of the TGF-β superfamily and plays critical roles in embryonic development, cell differentiation, tissue homeostasis, and disease. Initially identified for its ability to induce bone and cartilage formation, BMP-4 is now known to regulate the development and function of multiple organ systems.
BMP-4 signals by binding to type I and type II serine/threonine kinase receptors (BMPR-I/II) on the cell surface, activating downstream SMAD-dependent and -independent pathways. During embryogenesis, it drives the differentiation of mesoderm-derived tissues, including hematopoietic and renal lineages. BMP-4 also promotes osteogenic differentiation of mesenchymal stem cells, supports bone repair, maintains hematopoietic stem cell self-renewal, and inhibits preadipocyte differentiation.
This recombinant human BMP-4 is expressed in E. coli, supplied in liquid format, and characterized by high purity, high bioactivity, and low endotoxin levels—making it ideal for research applications in stem cell biology, developmental studies, and regenerative medicine.
Components
|
Components No. |
Name |
92070ES05 |
92070ES10 |
92070ES50 |
92070ES72 |
92070ES76 |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
2 μg |
10 μg |
50 μg |
250 μg |
500 μg |
Specifications
|
Components No. |
Name |
|
92070 |
Recombinant Human BMP-4 Protein, His Tag |
|
Protein Synonyms |
BMP2B ; BMP2B1; DVR4; MCOPS6; OFC11 ; ZYME |
|
Species |
Human |
|
Expression System |
E.coli |
|
Expression Sequence |
MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTN HAIVQTLVNSVNSSIP KACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH |
|
Accession |
P12644 |
|
Tag |
C-His |
|
Endotoxin |
< 1.0 EU per 1 μg of the protein by the LAL method |
|
Purity |
> 95%, determined by SDS-PAGE |
|
Activity |
The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. |
Storage
This product should be stored at -25~-15℃ for 1 year. Avoid repeated freeze–thaw cycles. Centrifuge briefly before opening the vial. It is recommended to aliquot the reagent into single-use portions.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Figure
1. Purity

Figure 1. Human BMP-4 on SDS-PAGE under reduced and non-reduced conditions. The purity is greater than 95%.
2. Cell Based Assay

Figure 2. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL.
Documents:
Safety Data Sheet
Manuals
결제 및 보안
귀하의 결제 정보는 안전하게 처리됩니다. 당사는 신용카드 정보를 저장하지 않으며 귀하의 신용카드 정보에 접근할 수 없습니다.
문의
당신은 또한 좋아할 수 있습니다
자주 묻는 질문
이 제품은 연구 목적으로만 사용되며 인간이나 동물의 치료 또는 진단용으로 의도되지 않았습니다. 제품과 콘텐츠는
특정 애플리케이션에는 추가적인 제3자 지적 재산권이 필요할 수 있습니다.
예슨은 윤리적 과학에 헌신하며, 우리의 연구가 안전과 윤리적 기준을 보장하는 동시에 중요한 문제를 해결해야 한다고 믿습니다.

