설명
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Documents:
Safety Data Sheet
Manuals
결제 및 보안
귀하의 결제 정보는 안전하게 처리됩니다. 당사는 신용카드 정보를 저장하지 않으며 귀하의 신용카드 정보에 접근할 수 없습니다.
문의
당신은 또한 좋아할 수 있습니다
자주 묻는 질문
이 제품은 연구 목적으로만 사용되며 인간이나 동물의 치료 또는 진단용으로 의도되지 않았습니다. 제품과 콘텐츠는
특정 애플리케이션에는 추가적인 제3자 지적 재산권이 필요할 수 있습니다.
예슨은 윤리적 과학에 헌신하며, 우리의 연구가 안전과 윤리적 기준을 보장하는 동시에 중요한 문제를 해결해야 한다고 믿습니다.

