شرح
Interleukin-6 (IL-6) is a pleiotropic cytokine that plays a crucial role in the acute-phase response, inflammation, bone metabolism, lymphocyte differentiation, and cancer progression. Dysregulation of IL-6 production is also implicated in various diseases, including rheumatoid arthritis, Alzheimer's disease, autoimmune disorders, and different types of cancer.
Specifications
|
Cat.No. |
90303ES08 |
|
Size |
5 μg |
Components
|
Name |
90303ES08 |
|
HiActi™ Recombinant Porcine IL-6 Protein, His Tag |
5 μg |
Performance parameters
|
Synonyms |
interleukin 6, IL6 |
|
Species |
Porcine |
|
Expression Sequence |
MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM with polyhistidine tag at the C-terminus. |
|
Accession |
P26893 |
|
Tag |
C-His |
|
Expression System |
E.coli |
|
Molecular Weight |
The protein has a calculated MW of 21.9 kDa. The protein migrates as 23 kDa under reducing condition |
|
Purity |
>98% as determined by SDS-PAGE. |
|
Endotoxin |
<0.1 EU per 1 μg of the protein by the LAL method. |
|
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
|
Appearance |
Lyophilized Powder |
|
Biological activity |
Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED₅₀ for this effect is <1.5 ng/mL. |
|
Reconstitution Instructions |
Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. |
Storage
Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 ~ 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use.
Notes
1. This product is for research use only.
2. Please operate with lab coats and disposable gloves,for your safety.
Documents:
Safety Data Sheet
Manuals:
Payment & Security
اطلاعات پرداخت شما با اطمینان پردازش می شود. ما جزئیات کارت اعتباری را ذخیره نمی کنیم و به اطلاعات کارت اعتباری شما دسترسی نداریم.
You may also like
Inquiry
FAQ
The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.
Certain applications may require additional third-party intellectual property rights.
Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.

