وصف
The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells.
Product Properties
|
Synonyms |
Glia maturation factor beta, GMF-beta |
|
Accession |
Q63228 |
|
GeneID |
81661 |
|
Source |
E.coli-derived rat Glia Maturation Factor beta protein,Ser2-His142 |
|
Molecular Weight |
Approximately 16.6 kDa. |
|
AA Sequence |
SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEWLREKLGFFH |
|
Tag |
None |
|
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
|
Purity |
> 98 % by SDS-PAGE and HPLC analyses. |
|
Biological Activity |
Data is not available. |
|
Endotoxin |
< 1.0 EU per 1μg of the protein by the LAL method. |
|
Formulation |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions. |
Shipping and Storage
The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.
Cautions
1. Avoid repeated freeze-thaw cycles.
2. For your safety and health, please wear lab coats and disposable gloves for operation.
3. For research use only!
Payment & Security
تتم معالجة معلومات الدفع الخاصة بك بشكل آمن. لا نقوم بتخزين تفاصيل بطاقة الائتمان ولا يمكننا الوصول إلى معلومات بطاقة الائتمان الخاصة بك.
You may also like
Inquiry
FAQ
The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.
Certain applications may require additional third-party intellectual property rights.
Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.

