Recombinant Human VEGF165 Protein _ 91517ES

YeasenSKU: 91517ES05

Size: 2 ug
سعر:
سعر البيع$60.00

الشحن محسوب عند الخروج

مخزون:
في الأوراق المالية

وصف

VEGF is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability.VEGF is expressed in vascularized tissues and plays an important role in normal and pathological angiogenesis.VEGF has been implicated in tumor metastasis and in the induction of intraocular neovascularization syndromes.VEGF signals through three types of receptors; fms-like tyrosine kinase (flt-1), the KDR gene product (the murine homolog is the flk-1 gene product) and the flt4 gene product. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two polypeptide chains of 165 amino acids.

This product, Recombinant Human VEGF165, is supplied as a lyophilized powder with high activity, high purity and low endotoxin.

Specification

Synonyms

Human Vascular Endothelial Growth Factor 165; MVCD1, VAS, vascular endothelial growth factor A, VEGF, VEGFA, VPF

Source

Human VEGF165 Protein is expressed from E.coli without tag.

Ala27-Arg191 with an N-terminal Methionine

Accession

P15692

Molecular Weight

Approximately 38.2 kDa.

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEE

SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDS

RCKARQLELNERTCRCDKPRR

Endotoxin

< 0.01 EU/μg by the LAL method.

Purity

> 96% by SDS-PAGE and HPLC.

Biological Activity

Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml.

Formulation

Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.

Physical Appearance

White lyophilized powder

Storage

-25 ~ -15 ° C storage, valid for 1 year after receipt.

After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.

Compounding Methods

Centrifuge before uncapping to bring contents to the bottom. Use sterile distilled water or PBS to re-dissolve and re-formulate to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long-term storage, it is recommended that carrier protein (0.1% BSA) be added to the dilution buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing.

Cautions

1. Please operate with lab coats and disposable gloves,for your safety.   

2. This product is for research use only.

Payment & Security

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

تتم معالجة معلومات الدفع الخاصة بك بشكل آمن. لا نقوم بتخزين تفاصيل بطاقة الائتمان ولا يمكننا الوصول إلى معلومات بطاقة الائتمان الخاصة بك.

You may also like

Inquiry

FAQ

The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.

Certain applications may require additional third-party intellectual property rights.

Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.