وصف
Components
|
Components No. |
Name |
20543ES10 |
20543ES60 |
|
20543 |
Recombinant Alkalitolerant Protein A |
10 mg |
100 mg |
Product Properties
|
Synonyms |
Recombinant protein A alkali-tolerant |
|
Source |
E.coli |
|
Molecular Weight |
Approximately 26.7 kDa, a single non-glycosylated polypeptide chain containing 237amino acids |
|
Amino Acid Sequence |
AQGTVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLND AQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLN DAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKL NDAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPKC |
|
Concentration for 1 unity OD at 280 nm |
4.4 mg/mL |
|
Physical Appearance |
> 97 % by SDS-PAGE and HPLC analyses. |
|
Purity |
> 97% by SDS-PAGE and HPLC analyses. |
|
Endotoxin Level |
<0.1 EU /1 μg of the protein by the LAL method. |
|
Formulation |
A 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4 or lyophilized from a 0.2 µm filtered solution in 20 mM PB,400 mM NaCl, pH7.4 |
|
Reconstitution |
Dissolve in distilled water or saline. |
Storage
This product should be stored at -25~ -15℃, valid for 12 months. Avoid repeated freeze-thaw cycles.
Notes
1. Please operate with lab coats and disposable gloves ,for your safety.
2. This product is for research use only.
Appendix
Table 1. Summary of Binding Abilities of Proteins A, G, and L to Ig from Different Species

Documents:
Safety Data Sheet
Manuals
Payment & Security
تتم معالجة معلومات الدفع الخاصة بك بشكل آمن. لا نقوم بتخزين تفاصيل بطاقة الائتمان ولا يمكننا الوصول إلى معلومات بطاقة الائتمان الخاصة بك.
You may also like
Inquiry
FAQ
The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.
Certain applications may require additional third-party intellectual property rights.
Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.

