وصف
Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight.
This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form.
Features
- Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination.
- Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation.
- High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales.
Components
|
Name |
20381ES01 |
20381ES03 |
20381ES08 |
20381ES25 |
20381ES60 |
|
Leupeptin (Ultra Pure) |
100 mg |
1 g |
5 g |
25 g |
100 g |
Specifications
|
Cas No. |
1169630-82-3 |
|
Peptide Sequence |
EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH |
|
Source |
Expressed in E. coli |
|
Molecular Weight |
3175.5 ± 1.0 Da |
|
Appearance |
Lyophilized powder |
|
Purity |
≥95% |
Storage
This product should be stored at -25~-15℃ for 2 years.
Notes
1. For your safety and health, wear a lab coat and disposable gloves while handling this product.
2. This product is intended for research use only.
Figure
1. Peptide Identity

Figure 1. Identity Confirmation of P29-Arg34 GLP-1(9-37) by HPLC Analysis
The chromatographic profile of Yeasen P29-Arg34 GLP-1(9-37) shows a consistent retention time with the reference standard, confirming the identity of the peptide.
2. High Purity

Figure 2. Purity Analysis of P29-Arg34 GLP-1(9-37) by HPLC Analysis
The HPLC profile demonstrates the high purity of Yeasen P29-Arg34 GLP-1(9-37), with a purity of ≥98%.
Documents:
Safety Data Sheet
Manuals
Payment & Security
تتم معالجة معلومات الدفع الخاصة بك بشكل آمن. لا نقوم بتخزين تفاصيل بطاقة الائتمان ولا يمكننا الوصول إلى معلومات بطاقة الائتمان الخاصة بك.
You may also like
Inquiry
FAQ
The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.
Certain applications may require additional third-party intellectual property rights.
Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.


